PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG009721.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family WRKY
Protein Properties Length: 232aa    MW: 26480.8 Da    PI: 9.9908
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG009721.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY37.93.6e-12137159123
                  ---SS-EEEEEEE--TT-SS-EE CS
         WRKY   1 ldDgynWrKYGqKevkgsefprs 23 
                  ldDgy+WrKYGqK vk+++fprs
  CCG009721.1 137 LDDGYRWRKYGQKAVKNNKFPRS 159
                  59********************8 PP

2WRKY551.6e-171712102059
                  S-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY  20 fprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    rsYYrCt++gC vkk+v+r ++d+ vv++tYeg H+h+
  CCG009721.1 171 LFRSYYRCTYQGCDVKKQVQRLTKDEGVVVTTYEGMHTHP 210
                  56*************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.3E-31122210IPR003657WRKY domain
SuperFamilySSF1182904.71E-24129211IPR003657WRKY domain
PROSITE profilePS5081124.34132212IPR003657WRKY domain
SMARTSM007745.8E-36137211IPR003657WRKY domain
PfamPF031065.8E-8138159IPR003657WRKY domain
PfamPF031062.1E-13172210IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MEANTFTTRD IEALSWKLRE ASDADMHHSS ILLPPNRSLK KVITRSPNYP VSSSMTNSSH  60
VFHNFQADSS GGFLGLKTET QHPVPRISPE INKDLNSQSV SFAIGSETEP QAAKKKGEKK  120
IRKPKYAFQT RSQVDILDDG YRWRKYGQKA VKNNKFPRSN RGVAATNDAY LFRSYYRCTY  180
QGCDVKKQVQ RLTKDEGVVV TTYEGMHTHP IEKPNDNFEH ILSQMQIYST PF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-23127211776Probable WRKY transcription factor 4
2lex_A3e-23127211776Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011000970.11e-116PREDICTED: probable WRKY transcription factor 75
TrEMBLB9GF441e-112B9GF44_POPTR; Uncharacterized protein
STRINGPOPTR_0001s33560.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.19e-53WRKY DNA-binding protein 75